PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_15599-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 129aa    MW: 14429.4 Da    PI: 5.276
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_15599-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.1e-182370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll+++++  G g+W++ ar+ g++Rt+k+c++rw++yl
  TRIUR3_15599-P1 23 RGPWTVEEDVLLANYIAANGEGRWNALARRAGLKRTGKSCRLRWLNYL 70
                     89*********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.981874IPR017930Myb domain
SMARTSM007172.4E-142272IPR001005SANT/Myb domain
PfamPF002491.6E-162370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-212484IPR009057Homeodomain-like
SuperFamilySSF466898.05E-182490IPR009057Homeodomain-like
CDDcd001675.33E-112570No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MACDQRGMRG EETAAGEEEM LRRGPWTVEE DVLLANYIAA NGEGRWNALA RRAGLKRTGK  60
SCRLRWLNYL RPDLRRGGLT AEEQLRGHKL TSLHAGLYAD VGFPELEFGG ETMWGACADD  120
LWCTDMLGL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3686905e-89AK368690.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2078D05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645266.15e-35PREDICTED: myb-related protein 340
SwissprotQ9SPG91e-32MYB24_ARATH; Transcription factor MYB24
TrEMBLT1MD684e-89T1MD68_TRIUA; Uncharacterized protein
STRINGMLOC_17928.25e-35(Hordeum vulgare)
STRINGORGLA07G0213800.11e-34(Oryza glaberrima)
STRINGLOC_Os07g48870.11e-34(Oryza sativa Japonica Group)
STRINGBGIOSGA026430-PA2e-34(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.16e-34myb domain protein 24